Your Notifications
Live
Get real time notifications when you receive a new feedback message
Show Live Notifications
Show
See all
literature
Starless (Part 1) The Execution Plaza
By gechol
5 Favourites0 Comments494 Views
In a galaxy far far away, in a planet who have no star to shine upon it, an eternal night, shadows been lurking on this planet for centuries. When a war between an Empire and its free people finally comes to an end. When a group of people discusses what kind of nation should be build to give light and hope for its people, a group of people is waiting outside. This group of people seems have no interest of politics, this people seems to love cover themselves in darkness. These people are Ladies of Darkness, mercenaries that brought together from different world through various contract to help the rebellion to overthrown the Empire.
Beneath their cloak they name are Aya, Regina, Rayne, Jill, Lara, Fio and Eri, or it was they once called before. A handsome muscular man figure approaching them "So what kind of reward i shall present for your services ladies?". "I want Blood, more blood to be spilled. It's make my heart race." Rayne says with a lick on her lips. Regina "I want a vast weaponry from the empire's armory". Meanwhile Fio and Eri want to be remembered as a history. Aya, Jill, and Lara hope they get a certain amount of gold before make it back to their planet. "Ok ladies i will see, what the rebellion can do to for your reward, meanwhile you can call me if you need anything else" The handsome guy give them his card. Nathan Clark, from F.O.X unit that rebel to the empire. Aya observe as the man disappear to the dark.
A week later the same man come to Ladies of Darkness hideout, they invite them to see a serial of execution will be taken place. They taken to plaza where lots of people can enjoy see their corrupt nobles and aristocrats get execute and their people and slaves get to participate in it. Rayne is so excited, as she sniff fear is everywhere, and blood make her hungry.
In the side of the road they have blindfold shot and archery. People pay to shot naked male and female aristocrats while blindfolded from the target.
Next, they have up and down game. Once for a lifetime game, where noble ladies must endure not to moan while people who pay can participate to have sex with them, in a guillotine set up where she bite a rope on her mouth that hold a giant blade on top of her. If the ladies fail, the blade will separate her head from her body, but also pull their loved one hanged beside them, as a second rope attached from the blade to the noose.
In the far side, the rebels executing male troops who fight for the empire. Their female officers given a chance to live in a deadly game of swing for your life. Where two female officers get hanged side-by-side, if they can press pull up button, a person beside her will have her noose pulled higher from the ground and their own noose lowered to the ground. The game end if someone manage to escape her demise, or both female officers die on the noose.
The next event happen after all the entertainment end. While only Rayne, enjoy her time participating here and there, all the person who highly contribute on the war is invited to see the last remaining show.
For the first event, lower class women who supporting empire is escorted to plaza and lined up against a strong wood placed vertical on the ground. Their wrist is chained behind the wood. They all look at each other not knowing what fate will fall upon them. Rayne get closer to one of the women and ask "Do you know what will happen next girl?" She ask while sniff her neck, playing her own desire to prey upon her victim. "I'm too afraid to find out M'Lady" she answer. "Dont be afraid sugar, because soon you will ascend from mortality" she said as she pull a rope from small hole behind her neck. She look terrified and squirms a little. Rayne then kisses her lips, while kissing her squirms goes wild as a man twist the lever, adjusting the garrote to bite on her neck. Rayne body is on heat watching the helpless woman squirm in her peril. Rayne lick her lips while occasionally touch herself in lustful manner. She then nods to the Ladies of Darkness, while they kindly help woman in front of them to wear their rope around their neck, and then followed by dozens helpful rebel hand helping the helpless women to wear their rope. The women look at each other anxiously waiting for someone to twist lever and tighten the rope on their neck. And suddenly one woman get her rope tighten and followed by another woman and another woman and another until the night is full of moaning and gagged sound once again.
The next morning (or night) the rebel has finish a big stage for the Imperial family. They are blindfolded and escorted to the grand gallows. The male members of the family get their first turn on the gallows, their female consorts are allowed to pleasure them for the last time. With both hands tied on their back, the male and female member of the imperial having their one last sex. When the men are screaming for their ejaculation, the executioner pull the lever that separate them from their female consort, making the dangling in ecstasy. The evil queen of the empire watched form the seemingly garroted chair with their daughters as her cousins, uncles, nephews and fathers hanged. The female family members then escorted the their gallows and placed noose on their neck. The queen once again must wait patiently as her sisters, aunts, nieces, and mothers fall from trap door, dancing to their death.
A sound come behind Rayne "How are you today MLady? Looks like you are enjoying our show" "Yes it was .... really something." Rayne reply as she blush on Nathan before back to observing the dangling women on their gallows. "Is the show boring? or is there a way we can entertain you more?" "There is a way actually . . . . " The queen loud yell break Rayne reply and everyone around "Never!!! I would never give myself or my daughter to the likes of you, i rather die than live through your humiliation!!!" A high rank rebel officer then slap her filthy mouth "Suits yourself evil bitch!!!".
The evil queen daughters then released from the garrote chair and placed on gallows "Please mother i beg you, change your mind!" say one of them "Mother we dont want to die!" say the other one. The evil queen cried looking on the noose been placed on her daughters. She wanted to say something but her muffled mouth cant speak anything behind her ducktape. Her blindfolded daughter is sent down hanging from the oldest to the youngest. The three sisters make her way to entertain the crowd, as people cheering for the princess slowly fade away to silent.
Finally the queen is release from her garrote chair and enter her grand gallows. She look down cursing on the people who brought down her empire. She then wear her noose without complain. A naughty officer touches her, making her loose her cool and swearing or cursing something behind her ducktape. The executioner then release the lever that drop her body to be hanged. The noose bites deeper and deeper to her neck. Thanks to the planet low gravity, the hanging sequence been longer, sexier, and more erotic than the one on earth. The queen keep fighting the noose as she give her best effort kick, thrash, wasting her precious breath. Her sexy muffled voice turn into a gag, before she finally still.
Rayne occasionally try to hide her lust for human death, but she cant stop her body from getting hot and touching herself on the neck. Nathan notice this, she offer her a steamy night on his tent. The other Ladies of Darkness get back to their hideout, as they are ready to receive their final reward, or that what they thought.
-credit-
Several inspiration image done by talented artist
Clench your teeth
Clench your teeth
kick the stick
Kick the Stick
Castle Garrote
Castle Garrote
Beneath their cloak they name are Aya, Regina, Rayne, Jill, Lara, Fio and Eri, or it was they once called before. A handsome muscular man figure approaching them "So what kind of reward i shall present for your services ladies?". "I want Blood, more blood to be spilled. It's make my heart race." Rayne says with a lick on her lips. Regina "I want a vast weaponry from the empire's armory". Meanwhile Fio and Eri want to be remembered as a history. Aya, Jill, and Lara hope they get a certain amount of gold before make it back to their planet. "Ok ladies i will see, what the rebellion can do to for your reward, meanwhile you can call me if you need anything else" The handsome guy give them his card. Nathan Clark, from F.O.X unit that rebel to the empire. Aya observe as the man disappear to the dark.
A week later the same man come to Ladies of Darkness hideout, they invite them to see a serial of execution will be taken place. They taken to plaza where lots of people can enjoy see their corrupt nobles and aristocrats get execute and their people and slaves get to participate in it. Rayne is so excited, as she sniff fear is everywhere, and blood make her hungry.
In the side of the road they have blindfold shot and archery. People pay to shot naked male and female aristocrats while blindfolded from the target.
Next, they have up and down game. Once for a lifetime game, where noble ladies must endure not to moan while people who pay can participate to have sex with them, in a guillotine set up where she bite a rope on her mouth that hold a giant blade on top of her. If the ladies fail, the blade will separate her head from her body, but also pull their loved one hanged beside them, as a second rope attached from the blade to the noose.
In the far side, the rebels executing male troops who fight for the empire. Their female officers given a chance to live in a deadly game of swing for your life. Where two female officers get hanged side-by-side, if they can press pull up button, a person beside her will have her noose pulled higher from the ground and their own noose lowered to the ground. The game end if someone manage to escape her demise, or both female officers die on the noose.
The next event happen after all the entertainment end. While only Rayne, enjoy her time participating here and there, all the person who highly contribute on the war is invited to see the last remaining show.
For the first event, lower class women who supporting empire is escorted to plaza and lined up against a strong wood placed vertical on the ground. Their wrist is chained behind the wood. They all look at each other not knowing what fate will fall upon them. Rayne get closer to one of the women and ask "Do you know what will happen next girl?" She ask while sniff her neck, playing her own desire to prey upon her victim. "I'm too afraid to find out M'Lady" she answer. "Dont be afraid sugar, because soon you will ascend from mortality" she said as she pull a rope from small hole behind her neck. She look terrified and squirms a little. Rayne then kisses her lips, while kissing her squirms goes wild as a man twist the lever, adjusting the garrote to bite on her neck. Rayne body is on heat watching the helpless woman squirm in her peril. Rayne lick her lips while occasionally touch herself in lustful manner. She then nods to the Ladies of Darkness, while they kindly help woman in front of them to wear their rope around their neck, and then followed by dozens helpful rebel hand helping the helpless women to wear their rope. The women look at each other anxiously waiting for someone to twist lever and tighten the rope on their neck. And suddenly one woman get her rope tighten and followed by another woman and another woman and another until the night is full of moaning and gagged sound once again.
The next morning (or night) the rebel has finish a big stage for the Imperial family. They are blindfolded and escorted to the grand gallows. The male members of the family get their first turn on the gallows, their female consorts are allowed to pleasure them for the last time. With both hands tied on their back, the male and female member of the imperial having their one last sex. When the men are screaming for their ejaculation, the executioner pull the lever that separate them from their female consort, making the dangling in ecstasy. The evil queen of the empire watched form the seemingly garroted chair with their daughters as her cousins, uncles, nephews and fathers hanged. The female family members then escorted the their gallows and placed noose on their neck. The queen once again must wait patiently as her sisters, aunts, nieces, and mothers fall from trap door, dancing to their death.
A sound come behind Rayne "How are you today MLady? Looks like you are enjoying our show" "Yes it was .... really something." Rayne reply as she blush on Nathan before back to observing the dangling women on their gallows. "Is the show boring? or is there a way we can entertain you more?" "There is a way actually . . . . " The queen loud yell break Rayne reply and everyone around "Never!!! I would never give myself or my daughter to the likes of you, i rather die than live through your humiliation!!!" A high rank rebel officer then slap her filthy mouth "Suits yourself evil bitch!!!".
The evil queen daughters then released from the garrote chair and placed on gallows "Please mother i beg you, change your mind!" say one of them "Mother we dont want to die!" say the other one. The evil queen cried looking on the noose been placed on her daughters. She wanted to say something but her muffled mouth cant speak anything behind her ducktape. Her blindfolded daughter is sent down hanging from the oldest to the youngest. The three sisters make her way to entertain the crowd, as people cheering for the princess slowly fade away to silent.
Finally the queen is release from her garrote chair and enter her grand gallows. She look down cursing on the people who brought down her empire. She then wear her noose without complain. A naughty officer touches her, making her loose her cool and swearing or cursing something behind her ducktape. The executioner then release the lever that drop her body to be hanged. The noose bites deeper and deeper to her neck. Thanks to the planet low gravity, the hanging sequence been longer, sexier, and more erotic than the one on earth. The queen keep fighting the noose as she give her best effort kick, thrash, wasting her precious breath. Her sexy muffled voice turn into a gag, before she finally still.
Rayne occasionally try to hide her lust for human death, but she cant stop her body from getting hot and touching herself on the neck. Nathan notice this, she offer her a steamy night on his tent. The other Ladies of Darkness get back to their hideout, as they are ready to receive their final reward, or that what they thought.
-credit-
Several inspiration image done by talented artist
Clench your teeth
Clench your teeth
kick the stick
Kick the Stick
Castle Garrote
Castle Garrote
asphyxiaasphyxiationdamselindistressdamselsindistressgallowsgarrotehangedgirlhangingnoosegarrottehangedwomanhangedwomenhangingfemalehanginggirlgarrottedasphyxiafetishhangingbytheneckhangingwomandamselinperildamselindistressperilhangedbytheneckdamselsinperilhangingfetishnoosefetishhangedfemaledamselinpleasurenooseperilasphyxiationperildamselsinpleasure
Published: | Mature
© 2018 - 2020 gechol
Comments0
Newest
Add a new comment...